PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00053.169
Common NameAMTR_s00053p00216880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 68aa    MW: 7898.3 Da    PI: 9.7093
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00053.169genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY58.11.8e-188462159
                                              -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                      WRKY 21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                                               rsYYrCt+++C+vkk+v+r ++d+++v++tYeg H+h+
  evm_27.model.AmTr_v1.0_scaffold00053.169  8 NRSYYRCTHHTCSVKKQVQRLSKDTSIVVTTYEGVHTHP 46
                                              6*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007742.5E-9647IPR003657WRKY domain
SuperFamilySSF1182904.18E-15747IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.5E-16746IPR003657WRKY domain
PfamPF031064.5E-14746IPR003657WRKY domain
PROSITE profilePS5081115.193948IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
MTVMMMSNRS YYRCTHHTCS VKKQVQRLSK DTSIVVTTYE GVHTHPCERL MESLSPLLKQ  60
MQFLTKF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAPTransfer from AT5G41570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006843497.21e-36PREDICTED: probable WRKY transcription factor 43
SwissprotQ9FFS38e-32WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLW1P5P62e-43W1P5P6_AMBTC; Uncharacterized protein
STRINGPOPTR_0002s16640.15e-34(Populus trichocarpa)
STRINGSi002751m1e-33(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.15e-33WRKY DNA-binding protein 24
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]